PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012205-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 554aa    MW: 62075.4 Da    PI: 8.733
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012205-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.8e-1774120148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEde l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
    NNU_012205-RA  74 KGGWTTEEDETLRKAVESFKGKCWKRIAEFFP-DRSEVQCLHRWQKVL 120
                      688*****************************.************986 PP

2Myb_DNA-binding605e-19126172148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
    NNU_012205-RA 126 KGPWTQEEDDKIIELVSKYGPTKWSIIAKSLP-GRIGKQCRERWHNHL 172
                      79******************************.*************97 PP

3Myb_DNA-binding57.23.8e-18178221146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++++k++w++
    NNU_012205-RA 178 KDAWTLEEELALMNAHRIHGNK-WAEIAKLLP-GRTDNSIKNHWNS 221
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.66869120IPR017930Myb domain
SuperFamilySSF466892.37E-1470126IPR009057Homeodomain-like
SMARTSM007171.6E-1473122IPR001005SANT/Myb domain
PfamPF002496.3E-1574120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2076126IPR009057Homeodomain-like
CDDcd001679.78E-1377120No hitNo description
PROSITE profilePS5129431.674121176IPR017930Myb domain
SuperFamilySSF466895.99E-32123219IPR009057Homeodomain-like
SMARTSM007172.8E-18125174IPR001005SANT/Myb domain
PfamPF002492.1E-18126172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-27127175IPR009057Homeodomain-like
CDDcd001671.39E-15128172No hitNo description
Gene3DG3DSA:1.10.10.604.4E-23176227IPR009057Homeodomain-like
SMARTSM007171.5E-16177225IPR001005SANT/Myb domain
PROSITE profilePS5129423.051177227IPR017930Myb domain
PfamPF002493.0E-16178221IPR001005SANT/Myb domain
CDDcd001672.58E-12180223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSTDSVPAIL LQPEMMIEVK NEQFCLQNKQ STAASNSSVS EGSCNIAPKS PGICSPASTS  60
PSHRRTTGPI RRAKGGWTTE EDETLRKAVE SFKGKCWKRI AEFFPDRSEV QCLHRWQKVL  120
NPELIKGPWT QEEDDKIIEL VSKYGPTKWS IIAKSLPGRI GKQCRERWHN HLDPMIKKDA  180
WTLEEELALM NAHRIHGNKW AEIAKLLPGR TDNSIKNHWN SSLKKKLDFY LATGKLPTAP  240
KNGLQNGAKD LSKPSNTGKP AACSNKRLGS TVEASPGNEI ICKLKDCKDH VESSRQRFPC  300
TDSSISISVA RHTDSDESES KAMASKLDMC CVASDFIPKF EKYRSNNEID QDNKDVNMLQ  360
FEVPSFGLYY EPPKLENCGI TLNPMLNTFG SNQQAYNSSP VMSPINFFTP PCVKGTGLDG  420
QSPESILRNA AKSFPNTPSI LRRRKREANA ALLHARIVQT DAVRNNNSLC SPEEKEKKIM  480
EQTESPNGSL FDIPSCDGSD TTGMYNGKDF NVSPLYCLRS KRTAIFKSVE KQLDFTLDEE  540
KFGTHTVHIQ KKWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-70732275159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-70732275159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264452.10.0PREDICTED: myb-related protein B-like
TrEMBLF6HLC50.0F6HLC5_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-150myb domain protein 3r-5